What is sermorelin?
Sermorelin is the synthetic, C-terminally amidated 1-29 fragment of human growth-hormone-releasing hormone (GHRH), also written GRF 1-29 or GHRH(1-29)-NH2. Its sequence, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, is identical to the first 29 residues of the natural hormone, with no substitutions. It acts on the GHRH receptor of the anterior pituitary and prompts the gland to release its own growth hormone (GH).[3][8]
The parent hormone was first isolated in 1982 not from the brain but from a pancreatic tumour that had caused acromegaly: a 44-amino-acid peptide whose synthetic copy stimulated GH secretion in vitro and in vivo. Deletion experiments soon showed that the hormone does not need its full length. In rat pituitary cells, the 29-residue amide kept about half the potency of the complete molecule; shorter fragments down to residue 21 were still active but far less potent, and activity disappeared at 1-19.[1][2]
That made GHRH(1-29)-NH2 the practical choice for a medicine: the shortest synthetic peptide with the full biological activity of GHRH, in the words of a 1999 drug review. Sermorelin is therefore the historical baseline of the GHRH-analogue family, the molecule against which later designs such as CJC-1295 and tesamorelin are compared.[8]
Continue reading:View Sermorelin
